PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_43.94
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HSF
Protein Properties Length: 503aa    MW: 54894.5 Da    PI: 5.1733
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_43.94genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.21.3e-242482260
                                 HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                 HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                                 Fl+k+y++++d++++++++ws++gnsfvv+   efa+++LpkyFkhsnf+SFvRQLn+Y
  evm.model.supercontig_43.94 24 FLSKTYDMVDDSSTNSVVTWSNSGNSFVVWSVPEFARDLLPKYFKHSNFSSFVRQLNTY 82
                                 9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.1E-261482IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.63E-221982IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.1E-2520177IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-142447IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.0E-202482IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-146274IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-147587IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009408Biological Processresponse to heat
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MDSIHDSISA VNSAAANGNS VPPFLSKTYD MVDDSSTNSV VTWSNSGNSF VVWSVPEFAR  60
DLLPKYFKHS NFSSFVRQLN TYVGIASFGI MLALFCPCLE VPVIDAAVAL RKPAHGHNHQ  120
PEVHSSSVGA CVEVGKFGLE EEVERLKRDK NILMQELVRL RQQQQNTEHQ LQNVGQKVQV  180
MEQRQQQMMS FLAKAMQSPG FLNQLVQQQS ESNRRIAGGN KKRRLPRQDK ENPSGHGVGC  240
PNGQIIKYKP SINEAAKAML HQISKLNTSA RLESSVNNPA SFLINDIPSS SVLENGSSLN  300
GVSGVTLSEV PPISAQSFMS TESRFPASCI ATSVSELQSS PHMVTDSPKA GQIPEMNVHH  360
SRDEIVLPGS TQMQDNMLGT TIGASDTNFM VSEAGNPEYM DRISAVLDGT DAIETDFVSE  420
DHDLAIFLDG ATQLPGINDA FWEQFLAASP LPVDTDEISP TSSESVTMKY QLQSSENGWD  480
KIQHINHLTD KMSLLTSESQ KG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B1e-1811821687Heat shock factor protein 1
5d5v_B1e-1811821687Heat shock factor protein 1
5d5v_D1e-1811821687Heat shock factor protein 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00514DAPTransfer from AT5G16820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007029602.10.0Heat shock factor protein HSF8, putative
TrEMBLA0A0B0N6I10.0A0A0B0N6I1_G
STRINGVIT_16s0039g01840.t011e-173(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22362371
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16820.24e-98heat shock factor 3